compare

Bustyelders.com

The best free busty fat mature movie site! 100% free Big Tits, Fat, Mature, Black and Big Ass porn videos updated daily! Busty fat black mature ass.
Links Website >> Google+ Linkedin
Top Keywords from Search Engines big ass, big ass movies + 3 more>>
Busty Elders Free Video Porn Site - Busty Fat Mature Women Movies!
Bustyelders.com is ranked 443,018th in the world (amongst the 30 million domains). This site is relatively popular among users in the Germany. It gets 32.1% of its traffic from the Germany . This site is estimated to be worth $8576. This site has a low Pagerank(1/10). It has 44 backlinks. Bustyelders.com has 35% seo score.
Popularity: Safety: undesirable Social signals: Legit: legal

Web Safety

bustyelders.com is a safe website, but Bustyelders is not safe for kids. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing: Safe
Avg Antivirus Safe
Wot Raiting Undesirable
SiteAdvisor n\a
Child Safety Very poor

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

Similar websites

Favicon of boltonone.com  

Boltonone.com

Bolton One | Health & Wellness

Boltonone.com

Popularity: | boltonone.com tags for boltonone.com elder care / health care / weight loss / course

Favicon of fatlossfactor.com  

Fatlossfactor.com

The Fat Loss Factor | Burn Fat Fast...

Learn how to lose a quick 25 pounds without diet pills or difficult exercises, and how to burn 12

Popularity: | fatlossfactor.com tags for fatlossfactor.com videos / fat / fat loss / weight loss

Favicon of elderlawanswers.com  

Elderlawanswers.com

Elder Law, Medicaid, Estate Planning And Long - Term Care...

Elder law answers, information about medicaid planning, medicare and nursing home rights

Popularity: | elderlawanswers.com tags for elderlawanswers.com elder law / elder law attorney / medicaid / medicare

Favicon of fatwreck.com  

Fatwreck.com

Fat Wreck Chords

Fat wreck chords punk rock record label.news, webstore, audio and video from nofx, strung out

Popularity: | fatwreck.com tags for fatwreck.com videos / fat / teenage bottlerocket / banner pilot

Favicon of elderlifehelp.com  

Elderlifehelp.com

Elderlife a Division of Locker Financial Services, Llc...

Elderlifes mission is to empower families and individuals who face lifestyle changes related to aging

Popularity: | elderlifehelp.com tags for elderlifehelp.com elder / elder care / aging

Favicon of miketnelson.com  

Miketnelson.com

Health And Fat Loss Articles bt dr Mike Nelson

Get health and fat loss tips articles from dr mike nelson.get the scientific true from dr mike andhis research team

Popularity: | miketnelson.com tags for miketnelson.com videos / video training / exercise videos

Favicon of houstoneldercareattorneys.com  

Houstoneldercareattorneys.com

Holland Elder Law

What you dont know about paying for care could cost you both your home and your life savings

Popularity: | houstoneldercareattorneys.com tags for houstoneldercareattorneys.com elder law lawyer / elder law

Favicon of cms.gov  

Cms.gov

Home - Centers For Medicare & Medicaid Services

Popularity: | cms.gov tags for cms.gov elder care / medicaid / health care / aging

Favicon of comfortkeepers.com  

Comfortkeepers.com

In-home Care, Senior Care - Comfort Keepers

Comfort keepers is a leading provider of in - home care for seniors and others needing assistance in

Popularity: | comfortkeepers.com tags for comfortkeepers.com elder care / in-home care / senior care / home care

Favicon of friskyttarna.eu  

Friskyttarna.eu

Friskyttarna | Ditt Ljus i Mmo-mörkret

Välkommen till sveriges trevligaste onlinespelsgemenskap.friskyttarna har funnits i en digital

Popularity: | friskyttarna.eu tags for friskyttarna.eu elder scrolls / elder scrolls online / guild wars 2 / world of tanks

Show more

Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

Domain PageRank Popularity Safety
Favicon for bustyexes.com   bustyexes.com Google PageRank for bustyexes.com
Favicon for bustyebonypics.com   bustyebonypics.com Google PageRank for bustyebonypics.com
Favicon for bustyebonybabes.com   bustyebonybabes.com Google PageRank for www.bustyebonybabes.com
Favicon for bustyerotica.net   bustyerotica.net Google PageRank for www.bustyerotica.net
Favicon for bustyescorts4u.com   bustyescorts4u.com Google PageRank for www.bustyescorts4u.com
Favicon for bustyescortsbangkok.com   bustyescortsbangkok.com Google PageRank for bustyescortsbangkok.com
Favicon for bustyexgfs.com   bustyexgfs.com Google PageRank for bustyexgfs.com
Favicon for bustyellen.com   bustyellen.com Google PageRank for bustyellen.com
Favicon for bustyebonyblog.com   bustyebonyblog.com Google PageRank for bustyebonyblog.com
Favicon for bustyebonypornstars.com   bustyebonypornstars.com Google PageRank for bustyebonypornstars.com

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Bustyelders.com is ranked 443,018th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 443,018 visit alexa Alexa backlinks: 71
This report show rough estimate of bustyelders.com's popularity
The top queries driving traffic to bustyelders.com from search engines.
big ass movies
big ass movie
agedblacks
big ass
big asses movies

Visitors Localization

Traffic Estimations Medium
Traffic Rank 443,018th most visited website in the World
Germany 32.1

General Statistics

Title: Busty Elders Free Video Porn Site - Busty Fat Mature Women Movies!
Description: The best free busty fat mature movie site! 100% free Big Tits, Fat, Mature, Black and Big Ass porn videos updated daily! Busty fat black mature ass.
Pagerank: Google PagerankTake this button and put in your website
SEO score: 35%
Website Worth: $8,576 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 443,018
Primary Traffic:
The country where current domain is most popular relative to the other countries
Germany
Alexa backlinks: 71
Webstatsdomain backlinks:
IP-address: 178.22.121.37 [Trace] [Reverse]
Server Location: Netherlands
Pageviews per User: 1.3
Average Time on Site: 00:46
Search Percent:
Estimated percentage of visits to bustyelders.com that came from a search engine
1.9%
Bounce:
Estimated percentage of visits to bustyelders.com that consist of a single pageview
74.3%
Daily Pageviews: n\a
Contact information: try to find contact info in whois information
Load Time: 0.15 seconds

Website categories

Currently, we found 15 categories on bustyelders.com
videos 319'761 sites older 1'558 sites
elder 2'722 sites old 18'156 sites
granny 5'188 sites mature 11'662 sites
fat 16'046 sites bbw 6'319 sites
big tits 10'675 sites mature sex 1'668 sites
mature women 1'508 sites porn videos 19'035 sites
grannies 878 sites big ass 1'501 sites
cougars 2'330 sites
Show more

Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="http://www.webstatsdomain.org">webstatsdomain</a>"

Your site has high probability to get under the filter Google, which called Google penguin.

  • busty porn videos ( 25% )
  • big tits porn( 25% )
  • free mature porn videos( 25% )
  • busty elders( 25% )

Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="http://www.webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • porn( 25% )
  • busty( 16% )
  • videos( 16% )
  • elders( 8% )
  • mature( 8% )
  • big( 8% )
  • tits( 8% )
  • free( 8% )

Websites hosted on same IP

Domain Popularity PageRank
Favicon for free-ebony-movies.com free-ebony-movies.com Check google pagerank for free-ebony-movies.com

Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not havea big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2014-07-28, website load time was 0.15. The highest load time is 0.75, the lowest load time is 0.15, the average load time is 0.30.

0reviews

Select

captcha
Enter the code shown above