compare

Sylvanianfamilies.com

Sylvanian Families, the world famous range of collectibles are now available to buy online. Sylvanian Families, the world famous range of collectibles are now available to buy online.
Links Website
Keywords sylvanian families, sylvanian family + 3 more>>
Contact Information See whois record for contact info
Sylvanianstorekeepers.com - Sylvanianstorekeepers.com
Sylvanianfamilies.com is ranked 988,754 in the world (among the 30 million domains) . This site is estimated worth $6594USD. This site has a good Pagerank(3/10). It has 0 backlinks. Sylvanianfamilies.com has 43% seo score.
Popularity: Safety: Social signals:
Google ads

Similar websites

Favicon of kidsfunreviewed.com  

Kidsfunreviewed.com

The Kids Fun Review - Everything Fun For Kids And Their Families

The kids fun review features fun things parents can do with their children, including birthday parties

Popularity: | kidsfunreviewed.com tags for kidsfunreviewed.com families / family / family dollar / children

Favicon of familiesonline.co.uk  

Familiesonline.co.uk

Home - Families Magazine Online

Familiesonline.co.uk is the national website for families magazines ltd, the uk - based group of localparenting magazines

Popularity: | familiesonline.co.uk tags for familiesonline.co.uk families / family / families group / family matters

Favicon of legacyfamilytree.com  

Legacyfamilytree.com

Legacy Family Tree Genealogy Software

Learn about legacy family tree ; the most comprehensive and easy - to - use genealogy/family history software

Popularity: | legacyfamilytree.com tags for legacyfamilytree.com families / family / legacy family tree / children

Favicon of bostoncentral.com  

Bostoncentral.com

Things to do in Boston Ma, Family & Kids Activities, Fun For All

Free things to do in boston ma and beyond including boston kids activities, fun for all, family events

Popularity: | bostoncentral.com tags for bostoncentral.com family fun / boston family / family kids

Favicon of way2hope.org  

Way2hope.org

Way2hope Home-help With Family And Life Problems

Help for families with problems in marriage, parenting, senior care, finances, abuse, addiction

Popularity: | way2hope.org tags for way2hope.org family / families / marriage

Favicon of musicfamilies.com  

Musicfamilies.com

Music & Families | Christmas in July | Ibanez Guitars Idaho |

Great southeast idaho music store, teaching studio, & family movement carrying ibanez guitars

Popularity: | musicfamilies.com tags for musicfamilies.com family / music family

Favicon of skisnowvalley.com  

Skisnowvalley.com

Barrie Ontario Family Ski Area - Skiing, Snowboarding, Tubing

Barrie ontario family ski area offers skiing, snowboard, snow tubing, catering and summer day camps

Popularity: | skisnowvalley.com tags for skisnowvalley.com family / families / nov / operation

Favicon of familiesbydesign.net  

Familiesbydesign.net

Families by Design of Boca Raton Counseling Therapy And Empowerment Services...

Looking for counseling therapy and empowerment services in boca raton? schedule a free consultationwith

Popularity: | familiesbydesign.net tags for familiesbydesign.net families / family

Favicon of legacyfamilytreestore.com  

Legacyfamilytreestore.com

Legacy Family Tree Online Store

Learn about legacy family tree - the most comprehensive and easy - to - use genealogy/family history

Popularity: | legacyfamilytreestore.com tags for legacyfamilytreestore.com family / families / legacy family tree / history

Favicon of surfsafely.com  

Surfsafely.com

Surfsafely.com, Family Friendly Search Engine, Internet Safety...

Family friendly web directory open only to pics rated sites.child safety online by informed

Popularity: | surfsafely.com tags for surfsafely.com families / family / family friendly / safety

Show more
Google ads

Sites with a similar domain name

We found 10 websites. With this list of domains you can understand how other people use the domain name with the same domain name

Domain PageRank Popularity Safety
Favicon for sylvanianfamilies-club.ru   sylvanianfamilies-club.ru Google PageRank for sylvanianfamilies-club.ru
Favicon for sylvanianfamilieshome.co.uk   sylvanianfamilieshome.co.uk Google PageRank for www.sylvanianfamilieshome.co.uk
Favicon for sylvanianfamiliesreview.com   sylvanianfamiliesreview.com Google PageRank for sylvanianfamiliesreview.com
Favicon for sylvanianfamiliesfieldviewmill.co.uk   sylvanianfamiliesfieldviewmill.co.uk Google PageRank for www.sylvanianfamiliesfieldviewmill.co.uk
Favicon for sylvanianfamiliessycamorecottage.co.uk   sylvanianfamiliessycamorecottage.co.uk Google PageRank for www.sylvanianfamiliessycamorecottage.co.uk
Favicon for sylvanianfamiliesforyou.com   sylvanianfamiliesforyou.com Google PageRank for sylvanianfamiliesforyou.com
Favicon for sylvanianfamiliesambulance.co.uk   sylvanianfamiliesambulance.co.uk Google PageRank for www.sylvanianfamiliesambulance.co.uk
Favicon for sylvanianfamiliescaravan.co.uk   sylvanianfamiliescaravan.co.uk Google PageRank for www.sylvanianfamiliescaravan.co.uk
Favicon for sylvanianfamiliesuk.info   sylvanianfamiliesuk.info Google PageRank for sylvanianfamiliesuk.info
Favicon for sylvanianfamiliessale.co.uk   sylvanianfamiliessale.co.uk Google PageRank for www.sylvanianfamiliessale.co.uk

General Statistics

Title: Sylvanianstorekeepers.com - Sylvanianstorekeepers.com
Description: Sylvanian Families, the world famous range of collectibles are now available to buy online. Sylvanian Families, the world famous range of collectibles... more
Pagerank: Google PagerankTake this button and put in your website
SEO score: 43%
Website Worth: $6,594 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 988,754
Alexa backlinks: 161
Webstatsdomain backlinks:
IP-address: 195.62.28.241 [Trace] [Reverse]
Server Location: United Kingdom
Date Registered: 2007-07-15 04:00:00
Site Age: 7 years and 0 months
Pageviews per User: 4.4
Average Time on Site: 01:44
Search Percent:
Estimated percentage of visits to www.sylvanianfamilies.com that came from a search engine
46.2%
Bounce:
Estimated percentage of visits to www.sylvanianfamilies.com that consist of a single pageview
42.3%
Daily Pageviews: n\a
Load Time: 0.75 seconds
Show more

Contact information:

@rosetimbertop1 - Rose Timbertop (RoseTimbertop1) в Твиттере
See sylvanianfamilies.com contact information in whois record

Website categories

Currently, we found 10 categories on sylvanianfamilies.com
sylvanian 109 sites families 46'652 sites
family 480'972 sites bamboo 11'548 sites
beagle 3'708 sites billabong 1'662 sites
brambles 105 sites cottontail 59 sites
delivery 88'069 sites holiday 125'920 sites
Show more

Visitors Localization

Traffic Estimations Low
Traffic Rank 988,754th most visited website in the World most visited website in the World

Alexa traffic graph

Alexa traffic rank show how popular a site is relative to other sites. Sylvanianfamilies.com is ranked 988,754 in the world (among the 30 million domains). A low rank means that your website gets a lot of visitors.

Alexa rank: 988,754 visit alexa Alexa backlinks: 161
This report show rough estimate of sylvanianfamilies.com's popularity
The top queries driving traffic to www.sylvanianfamilies.com from search engines.
sylvanian families
sylvanian family
sylvanian
sylvanians
sylvanian families shop

Web safety

sylvanianfamilies.com is safe website. This information from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety
Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

Domain Name

Using this list of sites you can analyze domain name

Domain Name: www.sylvanianfamilies.com
Registrar: Tucows.com Co
Domain Age: 7 years
Creation: 2007-07-15
Expiration: 2013-07-15
See sylvanianfamilies.com whois information

Websites hosted on same IP

Domain Popularity PageRank
Favicon for sylvanianfamiliesclub.com www.sylvanianfamiliesclub.com Check google pagerank for www.sylvanianfamiliesclub.com

Website Load Time

Website load time is important factor,because Google is taking site’s loading speed into consideration in determining its ranking. Even though this will not land a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – majority of visitors are usually in rush and no one is fond of waiting half a century before the website finally load its content or failed to load. At the last check on 2013-12-23, website load time was 0.75. The highest load time is 0.78, the lowest load time is 0.75, the average load time is 0.76.

Website worth

Estimated worth website
Copy & paste code at your website:
Estimated worth website
Copy & paste code at your website:
Get Widget!
Google ads

0reviews

Select

captcha
Enter the code shown above