compare

Sylvanianfamilies.com

Sylvanian Families, the world famous range of collectibles are now available to buy online. Sylvanian Families, the world famous range of collectibles are now available to buy online.
Links Website >> Google+ Linkedin
Top Keywords from Search Engines sylvanian families + 4 more>>
Sylvanian Families
Sylvanianfamilies.com is ranked 988,754th in the world (amongst the 30 million domains). This site is estimated to be worth $6271. This site has a good Pagerank(3/10). It has 9 backlinks. Sylvanianfamilies.com has 41% seo score.
Popularity: Safety: safe Social signals: Legit: legal
Advertising

Web Safety

sylvanianfamilies.com is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing: Safe
Avg Antivirus Safe
Wot Raiting n\a
SiteAdvisor Safe
Child Safety n\a

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

Google ads
Google ads

Similar websites

Favicon of kidsfunreviewed.com  

Kidsfunreviewed.com

The Kids Fun Review - Everything Fun For Kids And Their Families

The kids fun review features fun things parents can do with their children, including birthday parties

Popularity: | kidsfunreviewed.com tags for kidsfunreviewed.com games / families / children / toys

Favicon of toysdirect.com  

Toysdirect.com

Toys Direct, Childrens Toys From Playmobil, Sylvanian Families...

Buy toys online including playmobil, thomas the tank engine, sylvanian families and more

Popularity: | toysdirect.com tags for toysdirect.com sylvanian families / families / toys / playmobil

Favicon of wal-mart.com  

Wal-mart.com

Walmart.com: Save Money. Live Better.

Online shopping for the largest selection of electronics, home furnishings, video games, baby gear and more

Popularity: | wal-mart.com tags for wal-mart.com video games / shop online / shop gifts / toys

Favicon of naturescoursearts.com  

Naturescoursearts.com

| Natures Course Arts

Arts and crafts workshops and programs for families with kids ages 3 to 10.parents bond with theirkids

Popularity: | naturescoursearts.com tags for naturescoursearts.com child / families / children / kids

Favicon of bluestarfam.org  

Bluestarfam.org

Blue Star Families

Support. Connect. Empower. ,by military families for military families

Popularity: | bluestarfam.org tags for bluestarfam.org families / military children / blue star families / blue

Favicon of familiesfightingflu.org  

Familiesfightingflu.org

Families Fighting Flu

Families fighting flu is a website dedicated to protecting children against the flu

Popularity: | familiesfightingflu.org tags for familiesfightingflu.org families / children / sponsors

Favicon of leapfrog.com  

Leapfrog.com

Tablets For Kids | Best Childrens Learning Toys & Games & Nbsp...

Prepare your child for a lifetime of learning with educational toys from leapfrog! learn more abouttablets for kids

Popularity: | leapfrog.com tags for leapfrog.com children / games / shop apps / toys

Favicon of toysrus.com  

Toysrus.com

Toysrus.com, The Official Toys"r"us Site - Toys, Games...

Toys"r"us is the leading kids store for all toys, video games, dolls, action figures, learning games

Popularity: | toysrus.com tags for toysrus.com games / video games / children / toys

Favicon of almostfearless.com  

Almostfearless.com

Almost Fearless

Popularity: | almostfearless.com tags for almostfearless.com children / bilingual children / kids

Favicon of sylvanianfamilies-club.ru  

Sylvanianfamilies-club.ru

Sylvanian Families

Сайт любителей sylvanian families.мир sylvanian families

Popularity: | sylvanianfamilies-club.ru tags for sylvanianfamilies-club.ru sylvanian families / sylvanian

Show more

Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

Domain PageRank Popularity Safety
Favicon for sylvanianfamilies-club.ru   sylvanianfamilies-club.ru Google PageRank for sylvanianfamilies-club.ru
Favicon for sylvanianfamilieshome.co.uk   sylvanianfamilieshome.co.uk Google PageRank for www.sylvanianfamilieshome.co.uk
Favicon for sylvanianfamiliesreview.com   sylvanianfamiliesreview.com Google PageRank for sylvanianfamiliesreview.com
Favicon for sylvanianfamiliesfieldviewmill.co.uk   sylvanianfamiliesfieldviewmill.co.uk Google PageRank for www.sylvanianfamiliesfieldviewmill.co.uk
Favicon for sylvanianfamiliessycamorecottage.co.uk   sylvanianfamiliessycamorecottage.co.uk Google PageRank for www.sylvanianfamiliessycamorecottage.co.uk
Favicon for sylvanianfamiliesforyou.com   sylvanianfamiliesforyou.com Google PageRank for sylvanianfamiliesforyou.com
Favicon for sylvanianfamiliesambulance.co.uk   sylvanianfamiliesambulance.co.uk Google PageRank for www.sylvanianfamiliesambulance.co.uk
Favicon for sylvanianfamiliescaravan.co.uk   sylvanianfamiliescaravan.co.uk Google PageRank for www.sylvanianfamiliescaravan.co.uk
Favicon for sylvanianfamiliesuk.info   sylvanianfamiliesuk.info Google PageRank for sylvanianfamiliesuk.info
Favicon for sylvanianfamiliessale.co.uk   sylvanianfamiliessale.co.uk Google PageRank for www.sylvanianfamiliessale.co.uk

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Sylvanianfamilies.com is ranked 988,754th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 988,754 visit alexa Alexa backlinks: 143
This report show rough estimate of sylvanianfamilies.com's popularity
The top queries driving traffic to www.sylvanianfamilies.com from search engines.
sylvanian families
sylvanian family
sylvanian
sylvanians
sylvanian families shop

Visitors Localization

Traffic Estimations Low
Traffic Rank 988,754th most visited website in the World

General Statistics

Title: Sylvanian Families
Description: Sylvanian Families, the world famous range of collectibles are now available to buy online. Sylvanian Families, the world famous range of collectibles... more
Pagerank: Google PagerankTake this button and put in your website
SEO score: 41%
Website Worth: $6,271 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 988,754
Alexa backlinks: 143
Webstatsdomain backlinks:
IP-address: 219.94.164.43 [Trace] [Reverse]
Server Location: Japan (Osaka) [See domains hosted in Osaka | Japan]
Redirect: sylvanianfamilies.net[Analysis]
Date Registered: 2007-07-15 04:00:00
Site Age: 7 years and 1 months
Pageviews per User: 2
Daily Pageviews: n\a
Load Time: 2.58 seconds

Website categories

Currently, we found 6 categories on sylvanianfamilies.com
sylvanian families 244 sites sylvania 947 sites
children's games 65 sites families 44'364 sites
delivery 81'988 sites holiday 103'225 sites

Domain Name

Domain Name: www.sylvanianfamilies.com
Registrar: Tucows.com Co
Domain Age: 7 years and 1 months
Creation: 2007-07-15
Expiration: 2013-07-15
See sylvanianfamilies.com whois information

Keywords Consistency

In this table we show keywords that are most commonly found on the site. Words marked with 2 or 3 stars best describe the theme of the site.

  Keywords Freq Title Desc <H> Anchors
furniture 49
sylvania 29
school 24
sylvanian 20
room 16
  Keywords (2 words) Freq Title Desc <H> Anchors
room furniture 16
sylvanian families 11
down on the farm 11
bedroom furniture 9
living room 9
  Keywords (3 words) Freq Title Desc <H> Anchors
living room furniture 9
furniture living room 8
farm down on the farm 7
furniture bathroom furniture 7
furniture kitchen furniture 7

Headings

Your website is structured using HTML headings (<H2> to <H6>),but you need to use <H1> Heading Tag. Search engines place a lot of value on the text inside <H1> tags, so make sure that it's optimized and well represents the page content.

<H1> <H2> <H3> <H4> <H5> <H6>
000004
<H6> categories
<H6> other links
<H6> quick links
<H6> newsletter

Websites hosted on same IP

Domain Popularity PageRank
Favicon for sylvanianfamilies.co.za sylvanianfamilies.co.za Check google pagerank for sylvanianfamilies.co.za
Favicon for sylvanian-families.jp sylvanian-families.jp Check google pagerank for sylvanian-families.jp
Favicon for sylvanianfamilies.net sylvanianfamilies.net Check google pagerank for sylvanianfamilies.net
Favicon for sylvanianfamilies.de sylvanianfamilies.de Check google pagerank for sylvanianfamilies.de
Favicon for sylvanianfamilies.fr sylvanianfamilies.fr Check google pagerank for sylvanianfamilies.fr
Favicon for sylvanianfamilies.it www.sylvanianfamilies.it Check google pagerank for www.sylvanianfamilies.it
Favicon for sylvanianfamilies.hu sylvanianfamilies.hu Check google pagerank for sylvanianfamilies.hu
Favicon for sylvanianfamilies.nl sylvanianfamilies.nl Check google pagerank for sylvanianfamilies.nl
Favicon for sylvanianfamilies.pl sylvanianfamilies.pl Check google pagerank for sylvanianfamilies.pl
Favicon for sylvanianfamilies.lt sylvanianfamilies.lt Check google pagerank for sylvanianfamilies.lt

Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not havea big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2014-08-24, website load time was 2.58. The highest load time is 4.49, the lowest load time is 2.58, the average load time is 3.47.

Contact information:

http://www.sylvanianstorekeepers.com/aboutus - Sylvanianstorekeepers.com
http://www.sylvanianstorekeepers.com/contact-us - Sylvanianstorekeepers.com
Facebook profile for www.sylvanianfamilies.com - Sylvanian Families Shop, London - London, United Kingdom - Магазин игрушек, Коллекционный магазин | Facebook
@sylvanianshop - Sylvanian Shop (sylvanianshop) в Твиттере
See sylvanianfamilies.com contact information in whois record

0reviews

Select

captcha
Enter the code shown above