compare

Sylvanianfamilies.com

Sylvanian Families, the world famous range of collectibles are now available to buy online. Sylvanian Families, the world famous range of collectibles are now available to buy online.
Links Website Google+ Linkedin
Top Keywords from Search Engines sylvanian families, sylvanian family + 3 more>>
Sylvanianstorekeepers.com - Sylvanianstorekeepers.com
Sylvanianfamilies.com is ranked 988,754th in the world (amongst the 30 million domains). This site is estimated to be worth $6271. This site has a good Pagerank(3/10). It has 9 backlinks. Sylvanianfamilies.com has 41% seo score.
Popularity: Safety: safe Social signals: Legit: legal
Google ads

Web Safety

sylvanianfamilies.com is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing: Safe
Avg Antivirus Safe
Wot Raiting n\a
SiteAdvisor Safe
Child Safety n\a

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

Similar websites

Favicon of kidsfunreviewed.com  

Kidsfunreviewed.com

The Kids Fun Review - Everything Fun For Kids And Their Families

The kids fun review features fun things parents can do with their children, including birthday parties

Popularity: | kidsfunreviewed.com tags for kidsfunreviewed.com families / family / family dollar / children

Favicon of familiesonline.co.uk  

Familiesonline.co.uk

Home - Families Magazine Online

Familiesonline.co.uk is the national website for families magazines ltd, the uk - based group of localparenting magazines

Popularity: | familiesonline.co.uk tags for familiesonline.co.uk families / family / families group / family matters

Favicon of legacyfamilytree.com  

Legacyfamilytree.com

Legacy Family Tree Genealogy Software

Learn about legacy family tree ; the most comprehensive and easy - to - use genealogy/family history software

Popularity: | legacyfamilytree.com tags for legacyfamilytree.com families / family / legacy family tree / children

Favicon of way2hope.org  

Way2hope.org

Way2hope Home-help With Family And Life Problems

Help for families with problems in marriage, parenting, senior care, finances, abuse, addiction

Popularity: | way2hope.org tags for way2hope.org family / families / marriage

Favicon of musicfamilies.com  

Musicfamilies.com

Music & Families | Christmas in July | Ibanez Guitars Idaho |

Great southeast idaho music store, teaching studio, & family movement carrying ibanez guitars

Popularity: | musicfamilies.com tags for musicfamilies.com family / music family

Favicon of bostoncentral.com  

Bostoncentral.com

Things to do in Boston Ma, Family & Kids Activities, Fun For All

Free things to do in boston ma and beyond including boston kids activities, fun for all, family events

Popularity: | bostoncentral.com tags for bostoncentral.com family fun / boston family / family kids

Favicon of resortcamps.com  

Resortcamps.com

Family Camps, Resort Camps, Vacation Camps, Family Resorts, Family Camping...

Find family camps, resort camps, vacation camps, family resorts, family camping, family vacations

Popularity: | resortcamps.com tags for resortcamps.com family / family travel / family vacations

Favicon of skisnowvalley.com  

Skisnowvalley.com

Barrie Ontario Family Ski Area - Skiing, Snowboarding, Tubing

Barrie ontario family ski area offers skiing, snowboard, snow tubing, catering and summer day camps

Popularity: | skisnowvalley.com tags for skisnowvalley.com family / families / night skiing

Favicon of familiesbydesign.net  

Familiesbydesign.net

Families by Design of Boca Raton Counseling Therapy And Empowerment Services...

Looking for counseling therapy and empowerment services in boca raton? schedule a free consultationwith

Popularity: | familiesbydesign.net tags for familiesbydesign.net families / family

Favicon of childandfamilyservice.org  

Childandfamilyservice.org

Child & Family Service

Child & family service (cfs) of hawai‘i is a private, nonprofit founded in 1899

Popularity: | childandfamilyservice.org tags for childandfamilyservice.org family / families / child &amp family

Show more
Google ads

Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

Domain PageRank Popularity Safety
Favicon for sylvanianfamilies-club.ru   sylvanianfamilies-club.ru Google PageRank for sylvanianfamilies-club.ru
Favicon for sylvanianfamilieshome.co.uk   sylvanianfamilieshome.co.uk Google PageRank for www.sylvanianfamilieshome.co.uk
Favicon for sylvanianfamiliesreview.com   sylvanianfamiliesreview.com Google PageRank for sylvanianfamiliesreview.com
Favicon for sylvanianfamiliesfieldviewmill.co.uk   sylvanianfamiliesfieldviewmill.co.uk Google PageRank for www.sylvanianfamiliesfieldviewmill.co.uk
Favicon for sylvanianfamiliessycamorecottage.co.uk   sylvanianfamiliessycamorecottage.co.uk Google PageRank for www.sylvanianfamiliessycamorecottage.co.uk
Favicon for sylvanianfamiliesforyou.com   sylvanianfamiliesforyou.com Google PageRank for sylvanianfamiliesforyou.com
Favicon for sylvanianfamiliesambulance.co.uk   sylvanianfamiliesambulance.co.uk Google PageRank for www.sylvanianfamiliesambulance.co.uk
Favicon for sylvanianfamiliescaravan.co.uk   sylvanianfamiliescaravan.co.uk Google PageRank for www.sylvanianfamiliescaravan.co.uk
Favicon for sylvanianfamiliesuk.info   sylvanianfamiliesuk.info Google PageRank for sylvanianfamiliesuk.info
Favicon for sylvanianfamiliessale.co.uk   sylvanianfamiliessale.co.uk Google PageRank for www.sylvanianfamiliessale.co.uk

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Sylvanianfamilies.com is ranked 988,754th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 988,754 visit alexa Alexa backlinks: 161
This report show rough estimate of sylvanianfamilies.com's popularity
The top queries driving traffic to www.sylvanianfamilies.com from search engines.
sylvanian families
sylvanian family
sylvanian
sylvanians
sylvanian families shop

Visitors Localization

Traffic Estimations Low
Traffic Rank 988,754th most visited website in the World most visited website in the World

General Statistics

Title: Sylvanianstorekeepers.com - Sylvanianstorekeepers.com
Description: Sylvanian Families, the world famous range of collectibles are now available to buy online. Sylvanian Families, the world famous range of collectibles... more
Pagerank: Google PagerankTake this button and put in your website
SEO score: 41%
Website Worth: $6,271 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 988,754
Alexa backlinks: 161
Webstatsdomain backlinks:
IP-address: 195.62.28.241 [Trace] [Reverse]
Redirect: www.sylvanianstorekeepers.com[Analysis]
Date Registered: 2007-07-15 04:00:00
Site Age: 7 years and 1 months
Pageviews per User: 4.4
Average Time on Site: 01:44
Search Percent:
Estimated percentage of visits to www.sylvanianfamilies.com that came from a search engine
46.2%
Bounce:
Estimated percentage of visits to www.sylvanianfamilies.com that consist of a single pageview
42.3%
Daily Pageviews: n\a
Load Time: 3.23 seconds

Website categories

Currently, we found 10 categories on sylvanianfamilies.com
sylvanian 129 sites families 54'690 sites
family 557'399 sites bamboo 13'392 sites
beagle 4'377 sites billabong 1'946 sites
brambles 144 sites cottontail 62 sites
delivery 111'196 sites holiday 146'916 sites
Show more

Domain Name

Using this list of sites you can analyze domain name

Domain Name: www.sylvanianfamilies.com
Registrar: Tucows.com Co
Domain Age: 7 years and 1 months
Creation: 2007-07-15
Expiration: 2013-07-15
See sylvanianfamilies.com whois information

Keywords Consistency

In this table we show keywords that are most commonly found on the site. Words marked with 2 or 3 stars best describe the theme of the site.

  Keywords Freq Title Desc <H> Anchors
furniture 49
sylvania 29
school 24
sylvanian 20
room 16
  Keywords (2 words) Freq Title Desc <H> Anchors
room furniture 16
sylvanian families 11
down on the farm 11
bedroom furniture 9
living room 9
  Keywords (3 words) Freq Title Desc <H> Anchors
living room furniture 9
furniture living room 8
farm down on the farm 7
furniture bathroom furniture 7
furniture kitchen furniture 7

Headings

Your website is structured using HTML headings (<H2> to <H6>),but you need to use <H1> Heading Tag. Search engines place a lot of value on the text inside <H1> tags, so make sure that it's optimized and well represents the page content.

<H1> <H2> <H3> <H4> <H5> <H6>
000004
<H6> categories
<H6> other links
<H6> quick links
<H6> newsletter
Google ads

Websites hosted on same IP

Domain Popularity PageRank
Favicon for sylvanianfamiliesclub.com www.sylvanianfamiliesclub.com Check google pagerank for www.sylvanianfamiliesclub.com

Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not havea big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2014-07-22, website load time was 3.23. The highest load time is 4.49, the lowest load time is 3.23, the average load time is 3.70.

0reviews

Select

captcha
Enter the code shown above